PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA67G00029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 262aa    MW: 30046.1 Da    PI: 8.5445
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA67G00029genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k +G g+W++ +   g+ R++k+c++rw +yl
       AA67G00029 14 KGAWTKEEDKKLISYIKSHGEGSWRSLPTAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.31.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
       AA67G00029  67 RGNFTVDEDDLIIKLHSLLGNK-WSLIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.913961IPR017930Myb domain
SuperFamilySSF466891.91E-2913108IPR009057Homeodomain-like
SMARTSM007171.0E-121363IPR001005SANT/Myb domain
PfamPF002492.6E-151461IPR001005SANT/Myb domain
CDDcd001673.50E-91661No hitNo description
PROSITE profilePS5129428.29762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2765116IPR009057Homeodomain-like
SMARTSM007175.1E-1766114IPR001005SANT/Myb domain
PfamPF002494.1E-1667111IPR001005SANT/Myb domain
CDDcd001675.55E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRSPCCEKD HTNKGAWTKE EDKKLISYIK SHGEGSWRSL PTAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TVDEDDLIIK LHSLLGNKWS LIATRLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPTTHRSIN EPKTPRFSPK TEEPLVKNIS FATKLEKEEI FEEEERFRTQ KGVICCKEER  180
VEEEQCLDLN LELRISPPWQ GQKQRGKERY SMCTACRFGD GNGKECRCGS LQCKTEEIST  240
SSSYSSSDIS SSIGFDFLGF GL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013670604.11e-127PREDICTED: transcription factor MYB32-like
SwissprotO496081e-119MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A078BXM61e-125A0A078BXM6_BRANA; BnaC01g03510D protein
STRINGBra011576.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34990.11e-115myb domain protein 32